PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004501539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 384aa    MW: 44048.2 Da    PI: 6.556
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004501539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.71.1e-2681127147
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47 
                     k+ien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g+  
  XP_004501539.1  81 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRAT 127
                     68*****************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-3673132IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.12873133IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-3074154IPR002100Transcription factor, MADS-box
CDDcd002652.69E-3674147No hitNo description
PRINTSPR004041.1E-247595IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2582127IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-2495110IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-24110131IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MLLNSSSYYY LHYINRHLFL SFSALHHVTF YKCLKQTKFN HLNFFLISLF SSILATYVSK  60
FISLMPHEVN GKMGRVKLQI KKIENTTNRQ VTFSKRRNGL IKKAYELSVL CDVDVALIMF  120
SPSGRATLFS GNRSIEEIIE RYINLPDIER GRMHNQEHIR KFLSKLKVET EQICQPPSPV  180
ITDSQLKEIQ REIFICKSQL EEMENRLRIF EGDPSEITTL CEAEYREQVL QETLKQVQLR  240
KCILEEEHIS HASPQVHLTK TVDGFVAGTI ENALAWFPQE DTNNQILNFA NVYDPSPLSD  300
QQSLSTIADM VTPASTRLHS TFMDHNCQLS PRDVAEADIN NTISPQFGHV MDINSSSWEH  360
LHHLESGALS VAETGEGPYV QLQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-1573125153Myocyte-specific enhancer factor 2B
1tqe_Q2e-1573125153Myocyte-specific enhancer factor 2B
1tqe_R2e-1573125153Myocyte-specific enhancer factor 2B
1tqe_S2e-1573125153Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-48HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571575.10.0PREDICTED: MADS-box transcription factor 18-like isoform X2
RefseqXP_012571574.10.0PREDICTED: MADS-box transcription factor 18-like isoform X1
RefseqXP_004501539.10.0PREDICTED: MADS-box transcription factor 18-like isoform X1
TrEMBLG7ZXM51e-179G7ZXM5_MEDTR; MADS-box transcription factor
STRINGGLYMA04G04641.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136651922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.18e-53AGAMOUS-like 104